PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015881043.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family GRAS
Protein Properties Length: 548aa    MW: 61691.2 Da    PI: 6.6216
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015881043.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS447.87e-1371785481374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     l+++L++cA+avs++d +l + l+++l+ ++s +g+p+qRl ay++e+L arl++s+s++ykal+++e +   sse l+++++++e++P++kf++
  XP_015881043.1 178 LKQVLISCAKAVSDHDISLSRVLMNELRRMVSVSGEPIQRLGAYMLEGLVARLSSSGSNIYKALRCKEPA---SSELLSYMHILYELCPYFKFGY 269
                     5799*****************************************************************9...9********************* PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrled 188
                     + aN aI ea++ e+rvHiiDf+i qG QW++L+qa+a+Rp+gpp++RiTg++++ s   +   l+ +g++L+ +Ae++gvpfef++ +a +  d
  XP_015881043.1 270 MSANGAIAEAMKDENRVHIIDFQIAQGSQWITLIQAFAARPGGPPHIRITGIDDSVSAyaRGGGLNIVGKKLSALAESFGVPFEFHA-AAMSGCD 363
                     ******************************************************888899999************************.8999*** PP

            GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseeri 283
                     ++l++L v+pgEalaVn+++ lh+++desvs++++rd++L+lvkslsPkvv++veqe+++n++ F+ rfle+l+yy+a+f+s+++ lpr  +eri
  XP_015881043.1 364 VQLKNLGVRPGEALAVNFAFTLHHMPDESVSTQNHRDRLLRLVKSLSPKVVTLVEQESNTNTAAFFPRFLETLDYYMAMFESIDVALPRILKERI 458
                     *********************************************************************************************** PP

            GRAS 284 kvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     +vE+++l+re+vn++aceg er+erhe l+kWr r+++aGF+p+pls+ +++++k+ll ++ s+ yr+ee++g+l+lgW++r Lv+++aW+
  XP_015881043.1 459 NVEQHCLAREVVNIIACEGIERVERHELLGKWRLRFRMAGFTPYPLSSLVNATIKTLLVNYCSK-YRLEERDGALYLGWMNRDLVAACAWK 548
                     **************************************************************88.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098568.815152529IPR005202Transcription factor GRAS
PfamPF035142.4E-134178548IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0005737Cellular Componentcytoplasm
GO:0004871Molecular Functionsignal transducer activity
Sequence ? help Back to Top
Protein Sequence    Length: 548 aa     Download sequence    Send to blast
MQASQQQIRS SRMSNKLFYR PIKEEEYCLP QYQTLDHKLC YNDSSQSTHF FPQISRDLYC  60
TLESSSANGS YNIYNSPSTV SFSPNGSPMS QQDSHSYPPD QLQSPENTYG SPISGSCITD  120
DMSDFKYKLK ELESVMLGND FNIIDNYDNV FHNGTGNILQ QEIDDWGQIV QSISKRDLKQ  180
VLISCAKAVS DHDISLSRVL MNELRRMVSV SGEPIQRLGA YMLEGLVARL SSSGSNIYKA  240
LRCKEPASSE LLSYMHILYE LCPYFKFGYM SANGAIAEAM KDENRVHIID FQIAQGSQWI  300
TLIQAFAARP GGPPHIRITG IDDSVSAYAR GGGLNIVGKK LSALAESFGV PFEFHAAAMS  360
GCDVQLKNLG VRPGEALAVN FAFTLHHMPD ESVSTQNHRD RLLRLVKSLS PKVVTLVEQE  420
SNTNTAAFFP RFLETLDYYM AMFESIDVAL PRILKERINV EQHCLAREVV NIIACEGIER  480
VERHELLGKW RLRFRMAGFT PYPLSSLVNA TIKTLLVNYC SKYRLEERDG ALYLGWMNRD  540
LVAACAWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-621805486375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015869323.10.0PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_015869322.10.0PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_015881044.10.0PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_015881043.10.0PREDICTED: scarecrow-like transcription factor PAT1
SwissprotQ9LDL70.0PAT1_ARATH; Scarecrow-like transcription factor PAT1
TrEMBLM5WSC80.0M5WSC8_PRUPE; Uncharacterized protein
STRINGVIT_12s0057g00560.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16533497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein